PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006777-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 677aa    MW: 74475.9 Da    PI: 7.14
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006777-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.7e-1980126148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++++++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
    NNU_006777-RA  80 KGPWTKEEDDRIIELVEKYGCKKWSVIAKSLP-GRIGKQCRERWHNHL 126
                      79******************************.*************97 PP

2Myb_DNA-binding53.17.2e-17132174145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE++ l++a++ +G++ W+ Ia+ ++ gR ++++k++w+
    NNU_006777-RA 132 KDAWTKEEELALIRAHQIYGNK-WAEIAKLLP-GRADNSIKNHWN 174
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.2865574IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.6E-115586IPR009057Homeodomain-like
PROSITE profilePS5129430.92775130IPR017930Myb domain
SuperFamilySSF466895.99E-3277173IPR009057Homeodomain-like
SMARTSM007171.3E-1779128IPR001005SANT/Myb domain
PfamPF002491.3E-1880126IPR001005SANT/Myb domain
CDDcd001679.75E-1782126No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2687132IPR009057Homeodomain-like
SMARTSM007174.5E-16131179IPR001005SANT/Myb domain
PROSITE profilePS5129420.859131181IPR017930Myb domain
PfamPF002493.4E-15132174IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-22133181IPR009057Homeodomain-like
CDDcd001678.33E-13134174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MEEAKKEESN VEATKDVTVA STSSVSDSSC DTVVPKLGSV QGRTTGPTRR STKGAEWFPG  60
RSDVQCLHRW QKVLNPELIK GPWTKEEDDR IIELVEKYGC KKWSVIAKSL PGRIGKQCRE  120
RWHNHLNPAI KKDAWTKEEE LALIRAHQIY GNKWAEIAKL LPGRADNSIK NHWNCSVKKK  180
LDSYSAHGSL GDLPPIAFSD SYNHEIKVEH KRDEVVGRSP RTMVCFDKKV DTGNGVDANL  240
RGSILGNANG VQTHLQLWPV DIENCRSSKV EVDGLEKPSI ETLCDDKDAG ENGLTSEPCI  300
NNAKLSDDSQ HGIVVQSGKL CGVPFDDSLA LLHSNKSASV PADCKSLSSP QPPSLRVIVS  360
ASPYVALDMT ECSGRNGSPP ERSLPTTIKK SQESPKRPQN YAHFMNTSCG KDSRFNFQRY  420
SNFSRLSEHE FNGDNSVVGK HPKVSGTGHS EDTNYGRLCY EPPQLKDLNI ALATGGFSST  480
DNYFQKENNT VCYSTPPSCI QVTSGNGSSP DHILRSAARS YQNTPSIIRK RGREASKQAG  540
NSNDSDGICT PEARYGSSND RLRMMPFCDH GGQDDLNSTD LLNVKRLFLS PRNSPETETS  600
ALKSVEKRLE HAFDMEWDNP RAKCSPSTTA SDSSDAVHCS HTKVMPFDNS PESLVEHSGL  660
SWNFISPDSG CSCNSVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-625518133159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-625518133159MYB PROTO-ONCOGENE PROTEIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255475.10.0PREDICTED: uncharacterized protein LOC104596138
RefseqXP_010255474.10.0PREDICTED: uncharacterized protein LOC104596138
RefseqXP_010255473.10.0PREDICTED: uncharacterized protein LOC104596138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.12e-75Homeodomain-like protein